Home Contact Help user AWAROBOT project ALL Tables Preferences

Projects of db.astro.rug.astro-wise.org

Total number of projects 71
Total number of users 347

Click on a project name to set the project.Only projects you are a member of are selectable.

ID Project Privileges Instrument Member of Member count Manager(s)
1 ALL 4 None True public 0
2 MDM8K 4 MDM8K True public 0
3 OCAM@VST 4 OCAM True public 0
4 PDS 4 PDS True public 0
5 WFC@INT 4 WFC True public 0
6 WFI@2.2m 4 WFI True public 0
12 VESUVIO 4 OMEGACAM True public 0
13 OCAM ILT 2 OCAM False 10 0
14 KIDS 2 OMEGACAM False 76 29
101 WORKSHOP2005 2 WFI False 42 0
36 OMEGACAM@VST 4 OMEGACAM True public 12
202 COMM2011 2 OMEGACAM False 16 8
37 EUCLID 2 None False 50 1
38 OMEGAWHITE 2 OMEGACAM False 8 6
40 OMEGADWARFS 2 OMEGACAM False 11 6
41 ATLAS 4 OMEGACAM True public 4
42 VPHASPLUS 4 OMEGACAM True public 0
43 DECAM@BLANCO 4 DECAM True public 3
44 HERCULES 2 OMEGACAM False 11 6
45 VOICE 2 OMEGACAM False 21 4
104 TUTORIAL2014 2 None False 7 2
50 OMEGACLUSTER 2 OMEGACAM False 6 4
51 AMIGADEEP 2 OMEGACAM False 7 3
52 OMEGALAE 2 OMEGACAM False 5 3
5030 DDT295A5030 2 OMEGACAM False 4 4
9225 AWJMCFARLAND 0 None False 0 0
105 TUTORIAL2015 2 None False 14 4
54 KABS 2 OMEGACAM False 14 2
57 ALICE 2 OMEGACAM False 2 2
8 LOFAR 2 LOFAR False 4 0
10 ACS@HST 4 ACS True public 0
115 TESTCOMALS 2 ACS False 10 0
11 LBCBLUE@LBT 4 LBCBLUE True public 0
20 MONICA@WENDELSTEIN 4 MONICA True public 0
22 ISAAC@VLT 2 ISAAC False 6 0
201 TESTALL 2 None False 9 9
25 UKIDSS 2 WFCAM False 6 1
24 WFCAM@UKIRT 4 WFCAM True public 0
103 LEIDENTUTORIAL2008 2 None False 17 1
27 OCAM 2008 2 OCAM False 10 0
31 OMA 2 WFI False 3 0
33 VIRCAM@VISTA 4 VIRCAM True public 1
35 ESOSCHMIDT@ESO1m 5 ESOSCHMIDT True public 2
39 ACAM@WHT 4 ACAM True public 3
7 WENSS 4 WSRT True public 1
9233 AWDEMO 1 None False 0 0
102 BONN2005 2 None False 14 0
46 FOCUS 2 OMEGACAM False 42 8
47 MICADO@E-ELT 4 MICADO True public 3
9 SUP@SUBARU 4 SUP True public 1
15 COMALS 5 ACS True public 1
16 COMETS 2 None False 2 0
17 OCAMVSTGT 2 OMEGACAM False 3 0
48 KIDS-PHOTZTEST 2 OMEGACAM False 6 4
49 SPARCS 2 DECAM False 5 5
28 GRATAMA@BLAAUW 4 GRATAMA True public 1
18 STUDENTWISE 4 None True public 1
53 DEEPCLUSTERS 2 WFC False 14 8
106 TUTORIAL 2 None False 12 2
55 PAMC 2 OMEGACAM False 1 1
56 VEGAS 2 OMEGACAM False 4 3
119 TESTATLAS3D 2 None False 0 0
19 ATLAS3D 2 None False 0 0
58 YMCA 2 OMEGACAM False 4 4
21 ULTRAVISTA 2 None False 5 0
23 LBCRED@LBT 4 LBCRED True public 0
26 MEGACAM@CFHT 4 MEGACAM True public 3
29 ANDICAM@CTIO1.3m 4 ANDICAM True public 1
30 WISER 2 MEGACAM False 8 1
32 OCAM2009 2 OCAM False 10 0
34 VIKING 2 None False 36 7
AWAVENHOLAAWDBOXHOORNAWEHELMICHAWGVERDOES
AWJMCFARLANDAWPRAMIREZMORETAAWRPELETIER
AWATUDORICAAWEHELMICHAWGVERDOESAWHHILDEBRANDT
AWJMCFARLAND

Probing the accretion of matter around massive galaxy clusters with splashback

AWEHELMICHAWGVERDOESAWJHOLTAWJMCFARLAND
AWMFRANXAWRWILLIAMS

None

AWAVENHOLAAWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWGVERDOESAWJMCFARLANDAWRPELETIERAWWVRIEND

1700 Square degree 5 band survey of the equatorial strip and 2dF South region

VST GTO Hercules supercluster

Testing the photometric redshift and shear measurements of the Kilo Degree Survey

AWABOSELLIAWAGRADOAWAHELMIAWARAJ
AWASUAWAVENHOLAAWDBOXHOORNAWEGREBEL
AWEHELMICHAWEIODICEAWELAURIKAINENAWETOLOBA
AWEVALENTYNAWFGETMANAWFLABARBERAAWGHENSLER
AWGSIKKEMAAWGVANDEVENAWGVERDOESAWHBUDDELMEIJER
AWHSALOAWJDEJONGAWJFALCONBARROSOAWJJANZ
AWJMCFARLANDAWKKUIJKENAWMCAPACCIOLIAWMHILKER
AWMPAOLLILOAWMSPAVONEAWNNAPOLITANOAWNZABEL
AWRMUNOZAWRPELETIERAWSMIESKEAWSPAUDEL
AWSTRAGERAWTLISKERAWTPUZIAAWTSAIFOLLAHI
AWVSPRINGELAWWVRIEND

ACAM is mounted permanently at a folded-Cassegrain focus of the 4.2-m William Herschel Telescope. It can be used for high-throughput broad-band imaging, narrow-band imaging and low-resolution spectroscopy.

All public data for MDM8K

AWABELIKOVAWGSIKKEMAAWGVERDOES
AWDBOXHOORNAWEHELMICHAWGVERDOESAWMHEEMSKERK
AWMVANDENBERGAWSVATS

All public data for OCAM

AWOCONTIGIANI

INT data for Virtual Observations lecture series

All users

OmegaWhite is a variability survey aimed at periods of less than 2 hours. Using the wide-field camera OmegaCam on the VLT Survey Telescope (VST) 400 square degrees will be monitored for 2 hours in g' and in addition colour information will be obtained by imaging the same area in u', r', i' and narrow band He (5015) and Halpha filters. OmegaWhite is part of the European Galactic Plane Surveys (EGAPS). For additional information on OmegaWhite please have a look at this OmegaWhite survey website - http://www.astro.ru.nl/omegawhite/

Commissioning data for OmegaCAM, mostly taken from March through June of 2011.

AWJMCFARLAND
AWADVORNIKAWARAJAWDBOXHOORNAWEHELMICH
AWEVALENTYNAWFGETMANAWGSIKKEMAAWGVERDOES
AWJBOUTAWJDEJONGAWJMCFARLANDAWMBILICKI

All users

AWFGETMANAWMRADOVICH

All users

AWABELIKOV

All users

AWBBURGGRAFAWCTRACHTERNACHAWDBOMANSAWDROSENBAUM
AWFBRIMIOULLEAWHHILDEBRANDTAWHISRAELAWJDIETRICH
AWKWEISAWMLERCHSTERAWOCORDESAWOSCHMITHUESEN
AWTERBENAWTSCHRABBACKKRAHE
AWATUDORICAAWEHELMICHAWGVERDOESAWHHILDEBRANDT
AWJMCFARLAND
AWEHELMICHAWGVERDOESAWMVANDENBERGAWSVATS
AWJMCFARLAND

All users

All users

AWDBOXHOORNAWEHELMICHAWGRAMSAYAWGVERDOES
AWKBEGEMANAWPGROOTAWRTOMAAWSMACFARLANE
AWABELIKOVAWBPILADIEZAWBVENEMANSAWCBLOKZIJL
AWCSIFONAWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJBOUTAWJDEJONGAWJMCFARLANDAWJMWEBAZE
AWJPIZAGNOAWKBEGEMANAWKKUIJKENAWMCACCIATO
AWMCAPACCIOLIAWMNEESERAWMRADOVICHAWNIRISARRI
AWNWISSEAWPHERAUDEAUAWRBENDERAWRSAGLIA
AWRSILVOTTIAWRVANDERBURGAWRWILLIAMSAWSCASEWELL
AWSVLAARAWTERBENAWWVRIENDAWYMELLIER

Einstein cross around a massive super-compact galaxy in the KiDS survey: a VST follow-up

DECam is the 3 square-degree (2.2 degree wide) Dark Energy Camera mounted on the 4.0m Blanco telescope at Cerro Tololo Inter-American Observatory (CTIO) in central Chile for the purpose of collecting data for DES, the Dark Energy Survey.

AWGSIKKEMAAWGVERDOESAWJBOUT

Subaru is an 8.2 meter optical-infrared telescope at the summit of Mauna Kea, Hawaii, operated by the National Astronomical Observatory of Japan (NAOJ), National Institutes of Natural Science. SuprimeCam is the 10k x 8k mosaic camera at the prime focus.

AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGVERDOES
AWJDEJONGAWJMCFARLANDAWKBEGEMANAWMTEMPELAAR
AWRVERMEIJAWWVRIEND

All users

VOICE aims at covering 4 square degrees around the CDFS in deep ugri imaging.

AWEHELMICHAWGVERDOESAWJHOLTAWJMCFARLAND
AWMFRANX

VST/OmegaCAM Exploration of SUperclusters Voids and Intermediate Objects

One of three large surveys on the William Herschel Telescope (WHT) will be WEAVE-Clusters using the WEAVE Spectrograph. This will study cluster evolution through an analysis of the internal kinematics and stellar populations of dwarf galaxies. In preparation of this survey, deep imaging will be obtained with Wide Field Camera (WFC) on the Isaac Newton Telescope (INT) for some of these clusters. The resulting data set will be analyzed using special photometric techniques developed for the VST-Fornax Survey.

AWGVERDOESAWJBOUT

Data for the VISTA Kilo-degree Infrared Galaxy survey.

Contains scans of photographic plates taken with the ESO Schmidt 1m telescope on La Silla.

All users

AWABELIKOVAWEHELMICHAWGVERDOESAWJBOUT
AWJMCFARLANDAWJPIZAGNOAWRWILLIAMS

Sandbox for Astro-WISE tutorial users.

AWABELIKOVAWEHELMICHAWGVERDOESAWHBUDDELMEIJER
AWJMCFARLANDAWKBEGEMAN

All users

AWDBOXHOORNAWEIODICEAWMRADOVICHAWMSPAVONE

All users

AWJMCFARLAND

MegaPrime is the wide-field optical imaging facility at CFHT (Canada-France-Hawaii telescope) atop Mauna Kea, Hawaii. At the heart of MegaPrime is the wide-field imager, MegaCam, consisting of 36 2048 x 4612 pixel CCDs (a total of 340 megapixels), covering a full 1 degree x 1 degree field-of-view with a resolution of 0.187 arcsecond per pixel to properly sample the 0.7 arcsecond median seeing offered by the CFHT at Mauna Kea.

Groningen tutorial, July 10 and 11.

KiDS ATLAS Bridging Survey

AWACHOIAWCHEYMANSAWCSIFONAWDAPPLEGATE
AWDBOXHOORNAWEHELMICHAWFGETMANAWGCOVONE
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJDEJONGAWJMCFARLANDAWKKUIJKENAWMRADOVICH
AWMVACCARIAWMVIOLAAWNNAPOLITANOAWRVANDERBURG
AWTERBEN
AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGVERDOES
AWJDEJONGAWJMCFARLANDAWKBEGEMANAWMTEMPELAAR
AWRVERMEIJAWWVRIEND
AWDBOXHOORNAWEHELMICHAWGVERDOESAWHHILDEBRANDT
AWJDEJONGAWKKUIJKEN
AWDBOXHOORNAWDSOBRALAWGVERDOESAWJMATTHEE
AWJMCFARLAND

All users

AWASAVINOAWDBOXHOORNAWDDINGAWEHELMICH
AWJDEJONGAWKFRANTSEVAAWMMAHLKEAWNCHOQUE
AWOCONTIGIANIAWPMANCERAPINAAWTNUTMAAWYDEVRIES
AWEHELMICHAWGVERDOESAWJDEJONGAWJMCFARLAND

Project for the public data from the 0.4m Gratama telescope at the Blaauw Observatory atop the Bernoulliborg in Groningen, The Netherlands, run by the Kapteyn Institute.

Search for comets

AWATUDORICAAWGVERDOESAWJMCFARLAND
AWAKARICKAWCOMALSAWDBOXHOORNAWEHELMICH
AWEVALENTYNAWGVERDOESAWJMCFARLANDAWLDOMINGUEZ
AWMDENBROKAWMTEMPELAAR
AWGVERDOES
AWDBOXHOORNAWMGATTOAWMSPAVONEAWVRIPEPI

MYDB for AWDEMO

AWABELIKOVAWDBOXHOORNAWEDEULAWEHELMICH
AWEVALENTYNAWGSIKKEMAAWGVERDOESAWHBUDDELMEIJER
AWJBOUTAWJDEJONGAWJMCFARLANDAWJPIZAGNO
AWKBEGEMANAWKKUIJKENAWRHOOKAWWVRIEND

Test project for AIUB

A census of the close-binary population in old open clusters.

All users

MICADO will be a near-infrared wide-field camera at the European Extremely Large Telescope.

The Large Binocular Camera (blue arm) at the Large Binocular Telescope at Mount Graham

OmegaCAM lab tests

OmegaCAM/VST Guaranteed Time

This project contains all public data from the MONICA CCD camera on the 0.8m telescope at Wendelstein Observatory, operated by the Institute for Astronomy and Astrophysics of the University of Munich.

AWATUDORICAAWAVENHOLAAWEHELMICHAWEPETRILLO
AWGVERDOESAWMVANDENBERGAWSVATS
AWEHELMICHAWJDEJONG

None

LOw Frequency ARray - The largest radio telescope in the world

The HST-ACS Coma Legacy Survey

AWOCONTIGIANI

All public data for all instruments

All public data for WFI

AWDBOXHOORNAWGVERDOESAWJMCFARLAND

Astro-Wise Workshop - 14-18 November 2005, Lorentz Center, Leiden.

All users

UKIDSS (UKIRT Infrared Deep Sky Survey) is the next generation near-infrared sky survey, the successor to 2MASS using the infrared WFCAM survey instrument attached to the UK InfraRed Telescope (UKIRT) on Mauna Kea, Hawaii. UKIDSS began in May 2005 and will survey 7500 square degrees of the Northern sky, extending over both high and low Galactic latitudes, in JHK to K=18.3. This depth is three magnitudes deeper than 2MASS. UKIDSS will be the true near-infrared counterpart to the Sloan survey, and will produce as well a panoramic clear atlas of the Galactic plane.

The initial aim of ATLAS is to survey 4500 deg2 of the Southern Sky at high galactic latitudes to comparable depths to the SDSS in the North. The VST ATLAS will be the first step towards a panoramic digital survey of the Southern Sky in the optical bands.

AWJMCFARLAND

All users

OMA (ontological machine for Astro-Wise) is a prototype of the system for incorporation of external data sources in Astro-Wise. It will be used to test scientific use cases for OMA as well.

AWDBOXHOORNAWEHELMICHAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLANDAWKBEGEMAN
AWWVRIEND
AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWJBOUTAWJMCFARLANDAWKBEGEMAN
AWLKELVINAWRBUTAAWWVRIEND
AWEDEMOOIJAWEDEULAWEHELMICHAWEVANUITERT
AWGVERDOESAWHHILDEBRANDTAWISNELLENAWJHOLT
AWJMCFARLANDAWKKUIJKENAWKVERBEEKAWMFRANX
AWMSMITAWMVELANDERAWOSPOORENAWRWILLIAMS
AWTSCHRABBACKKRAHE
AWDBOXHOORNAWJDEJONGAWJMCFARLANDAWNNAPOLITANO

Leiden Tutorial. August 18-20.

For testing purposes only.

AWAGRADOAWANONYMOUSAWAROJBIAWCHAINES
AWDBOXHOORNAWDWILMANAWEBERTINAWEDEUL
AWEHELMICHAWEVALENTYNAWFGETMANAWGFEULNER
AWGSIKKEMAAWGVERDOESAWHHILDEBRANDTAWJDIETRICH
AWJKOPPENHOEFERAWJMCFARLANDAWJSNIGULAAWKBEGEMAN
AWKKOVACAWKKUIJKENAWLHABERZETTLAWLMORALESRUEDA
AWMNEESERAWMPAVLOVAWMPOHLENAWMSMIT
AWMTEMPELAARAWNRAMANUJAMAWOCORDESAWOSCHMITHUESEN
AWPGROOTAWPHERAUDEAUAWRRENGELINKAWRSILVOTTI
AWRVERMEIJAWSLECCIAAWTERBENAWTSCHNEIDER
AWWVRIENDAWYMELLIER

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

AWARAJAWARIFATTOAWDBOXHOORNAWEPUDDU
AWEVALENTYNAWFGETMANAWFLABARBERAAWGVERDOES
AWJDEJONGAWKKUIJKENAWMDALLORAAWMPAOLILLO
AWMRADOVICHAWNNAPOLITANO

All users

In this project we observed with VST-OmegaCam in the ugri bands a sample of galaxy clusters selected from the Planck-SZ catalog at different redshifts. The data will be used to calibrate the mass estimate of the clusters by weak-lensing and the cluster mass/richness relation, that will be applied to larger samples available from other surveys such as KiDS

All public data for VIRCAM

AWEHELMICHAWGVERDOESAWJDEJONGAWKKUIJKEN
AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWJBOUTAWJDEJONGAWJMCFARLAND

None

AWEHELMICHAWGVERDOESAWJMCFARLAND

The Wide-field Imaging Survey Evaluation of Readiness (WISER) project seeks to evaluate the readiness of our system to deal with large-scale survey data from wide-field imagers.

AWEHELMICH

All users

All users

AWDBOXHOORNAWEIODICEAWMSPAVONE
AWJMCFARLAND

All users

AWARAMESHAWAVENHOLAAWBLAPAWDBOXHOORN
AWEHELMICHAWGSIKKEMAAWGVERDOESAWJDEJONG
AWJMCFARLANDAWJVANDENBORNAWNCHOQUEAWPMANCERAPINA
AWRPELETIERAWTVOS
AWARAJAWFGETMAN
AWDBOXHOORNAWEHELMICHAWETOLSTOYAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJMCFARLANDAWKKUIJKENAWTDEBOER

All public data for ACS

AWEHELMICHAWGVERDOES

WFCAM is a near-IR wide field camera for the UKIRT telescope on Mauna Kea, Hawaii that has been designed specifically to carry out large-scale survey observations such as the UKIRT Infrared Deep Sky Survey (UKIDSS).

AWABELIKOVAWACHAMBALLUAWAJAFFEAWAPIEMONTE
AWATSYGANOVAWBDROEGEAWBNICHOLAWCBACCIGALUPI
AWCROUSSELAWCTAOAWDBOXHOORNAWEAUBOURG
AWEHELMICHAWEVALENTYNAWFABDALLAAWFRAISON
AWGBLANCAWGSIKKEMAAWGVERDOESAWHBUDDELMEIJER
AWJDEJONGAWJKOPPENHOEFERAWJMCFARLANDAWJMOHR
AWJPIZAGNOAWJSNIGULAAWKBEGEMANAWKGANGA
AWKKUIJKENAWMJARVISAWMKUEMMELAWMSAUVAGE
AWMVACCARIAWMWETZSTEINAWNBUSCAAWOLAHAV
AWOMARGGRAFAWPHUDELOTAWRCABANACAWRHENDERSON
AWRSAGLIAAWRWILLIAMSAWSDESAIAWSSERJEANT
AWTERBENAWTGIANNANTONIOAWVBECKMANNAWWMULDER
AWWVRIENDAWYMELLIER

Project for the public data from the ANDICAM (A Novel Dual Imaging CAMera) mounted on the former 1.3m 2MASS telescope at Cerro Tololo observatory, Chile. The ANDICAM has two detectors that can operate simultaneously, observing the same pointing in both the optical and near-infrared.

AWWVRIEND
AWADVORNIKAWAGRADOAWARAJAWARIFATTO
AWAWRIGHTAWCTORTORAAWDBOXHOORNAWDKLAES
AWEDEULAWEHELMICHAWEPUDDUAWEVALENTYN
AWFGETMANAWGCOVONEAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLANDAWKKUIJKEN
AWMBILICKIAWMDALLORAAWMIRWINAWMPAOLILLO
AWMRADOVICHAWNNAPOLITANOAWOCORDESAWPHUDELOT
AWTERBEN
AWJMCFARLAND
AWEVALENTYNAWGVERDOESAWJMCFARLAND

Sandbox for Astro-WISE tutorial users.

AWDBOXHOORNAWEHELMICHAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLANDAWKBEGEMAN
AWWVRIEND

The nature, clustering and evolution of Lyman-¿ emitters with the largest Lyman-¿ survey at z ¿ 2.4

AWAVENHOLAAWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWJDEJONGAWJMCFARLANDAWNCHOQUEAWPMANCERAPINA
AWEHELMICHAWGVERDOESAWJDEJONGAWJMCFARLAND

FOrnax Cluster Ultradeep Survey

All public data for OmegaCAM. OmegaCAM is a 1 square degree wide field, optical, 16k X 16k pixel camera for the VLT Survey Telescope (VST) on Paranal Observatory.

AWJMCFARLAND

All users

AWEHELMICHAWGVERDOESAWJMCFARLAND

The VST/OmegaCam Photometric H¿ Survey of the Southern Galactic Plane.

AWADVORNIKAWASUAWCSPINIELLOAWEHELMICH
AWEIODICEAWGDAGOAWGVERDOESAWJDEJONG
AWJMCFARLANDAWLKELVINAWMBILICKIAWMSPAVONE
AWRPELETIERAWTSAIFOLLAHI

Search for faint features in the outskirts of isolated galaxies

AWEHELMICHAWGVERDOES

All users

In december 2009 the CCD 'Sculptor' of the OmegaCAM detector was replaced. The data in this project were taken to confirm the success of this procedure. RawFitsData were created artificially; the order of extensions is not constant or the same as in the other OCAM datasets.

All users

AWFGETMANAWMRADOVICH

A survey to study the star formation history and the extended structure of the outskirts of the Magellanic Clouds

The Large Binocular Camera (red arm) at the Large Binocular Telescope at Mount Graham

AWDBOXHOORNAWEVALENTYNAWGVERDOESAWJBOUT
AWJMCFARLANDAWKBEGEMAN
AWDBOXHOORNAWJDEJONGAWJMCFARLANDAWNNAPOLITANO

All users

All users

MYDB for JMCFARLAND

All users

AWGVERDOESAWJMCFARLANDAWWVRIEND
AWAUSOVAWDBOXHOORNAWEVALENTYNAWWVRIEND

All users

AWDBOXHOORNAWEHELMICHAWGVERDOESAWKBEGEMAN
AWPGROOTAWSMACFARLANE

All public data for PDS

All users

Ultra deep near-infrared survey for the early Universe.

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

AWABELIKOVAWACHOIAWADVORNIKAWAEDGE
AWAGRADOAWARAJAWARIFATTOAWATUDORICA
AWAWRIGHTAWBALTIERIAWBJOACHIMIAWBVENEMANS
AWCHEYMANSAWCMORRISONAWCSIFONAWCSPINIELLO
AWCTORTORAAWDBOXHOORNAWDKLAESAWDWILLIAMS
AWEDEULAWEHELMICHAWEIODICEAWEPETRILLO
AWEPUDDUAWEVALENTYNAWEVANUITERTAWFGETMAN
AWFKOEHLINGERAWFLABARBERAAWGCOVONEAWGDAGO
AWGSIKKEMAAWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWHHOEKSTRAAWJDEJONGAWJMCFARLANDAWJPEACOCK
AWKBEGEMANAWKFRANTSEVAAWKKUIJKENAWLKELVIN
AWLMILLERAWMBILICKIAWMCAPACCIOLIAWMCOSTADUARTE
AWMDALLORAAWMIRWINAWMMAHLKEAWMPAOLILLO
AWMRADOVICHAWMSPAVONEAWMVIOLAAWNNAPOLITANO
AWOCORDESAWPHUDELOTAWPNOORISHADAWPSCHNEIDER
AWPSIMONAWRHERBONNETAWRNAKAJIMAAWRPELETIER
AWRVANDERBURGAWSDRIVERAWTERBENAWTKITCHING
AWTLISKERAWTSCHRABBACKKRAHEAWTSHANKSAWWMULDER
AWWSUTHERLANDAWWVRIENDAWYDEVRIESAWZHUANG
AWABELIKOVAWDBOXHOORNAWEHELMICHAWGVERDOES
AWJMCFARLANDAWJMWEBAZEAWKBEGEMANAWWVRIEND

The Spitzer Adaptation of the Red-sequence Cluster Survey is a z'-passband imaging survey of the SWIRE Legacy Survey Fields. Observations of the six fields have been made at all seven Spitzer (3.6, 4.5, 5.8, 8.0, 24, 70, 160 micron) passbands. SpARCS consists of deep (z'= 24 AB) observations made from both hemispheres using MegaCam at CFHT (Northern Fields) and MOSAICII at CTIO (Southern Fields). The cluster detection (z'-imaging) phase is now complete and has yielded hundreds of z > 1 cluster candidates detected based upon z'-[3.6] color. With a total effective area of 41.9 square degrees, SpARCS is currently the largest completed z > 1 cluster survey. This project is for the processing of new (DECAM) and legacy SpARCS data.

This project contains data taken during the OmegaCAM integration test of October 2008. Instrument and detector were reassembled on Paranal, but not joined together. The shutter and filter mechanics were operated but not present in front of the detector.

AWEHELMICHAWETOLSTOYAWGSIKKEMAAWGVERDOES
AWJDEJONGAWTDEBOER

The HST-ACS Coma Legacy Survey uses new data from the Hubble Space Telescope's Advanced Camera for Surveys and legacy data sources such as Subaru, Isaac Newton Telescope, etc. to study the nature of objects in and around the Coma Cluster.

AWDBOXHOORNAWEHELMICHAWEVALENTYNAWGVERDOES
AWJDEJONGAWJMCFARLANDAWKBEGEMANAWMTEMPELAAR
AWRVERMEIJAWWVRIEND
AWDBOXHOORNAWMGATTOAWMSPAVONEAWVRIPEPI

The Westerbork Northern Sky Survey

Euclid is an ESA medium class mission selected for launch in 2019 in the Cosmic Vision 2015-2025 programme

All users

All public data for WFC

AWEHELMICHAWGCOVONEAWGVERDOESAWMVACCARI

empowered by

logo