Home Contact Help user awanonymous project ALL Tables Preferences

Projects of db.astro.rug.astro-wise.org

Total number of projects 67
Total number of users 328

Click on a project name to set the project.Only projects you are a member of are selectable.

ID Project Privileges Instrument Member of Member count Manager(s)
1 ALL 4 None True public 0
10 ACS@HST 4 ACS True public 0
101 WORKSHOP2005 2 WFI True 42 0
102 BONN2005 2 None False 14 0
103 LEIDENTUTORIAL2008 2 None False 17 1
104 TUTORIAL2014 2 None False 7 2
105 TUTORIAL2015 2 None False 13 4
106 TUTORIAL 2 None False 7 2
11 LBCBLUE@LBT 4 LBCBLUE True public 0
115 TESTCOMALS 2 ACS False 10 0
119 TESTATLAS3D 2 None False 0 0
12 VESUVIO 4 OMEGACAM True public 0
13 OCAM ILT 2 OCAM False 10 0
14 KIDS 2 OMEGACAM False 73 28
15 COMALS 5 ACS True public 1
16 COMETS 2 None False 2 0
17 OCAMVSTGT 2 OMEGACAM False 3 0
18 STUDENTWISE 4 None True public 1
19 ATLAS3D 2 None False 0 0
2 MDM8K 4 MDM8K True public 0
20 MONICA@WENDELSTEIN 4 MONICA True public 0
201 TESTALL 2 None False 9 9
202 COMM2011 2 OMEGACAM False 16 8
21 ULTRAVISTA 2 None False 5 0
22 ISAAC@VLT 2 ISAAC False 6 0
23 LBCRED@LBT 4 LBCRED True public 0
24 WFCAM@UKIRT 4 WFCAM True public 0
25 UKIDSS 2 WFCAM False 6 1
26 MEGACAM@CFHT 4 MEGACAM True public 3
27 OCAM 2008 2 OCAM False 10 0
28 GRATAMA@BLAAUW 4 GRATAMA True public 1
29 ANDICAM@CTIO1.3m 4 ANDICAM True public 1
3 OCAM@VST 4 OCAM True public 0
30 WISER 2 MEGACAM False 8 1
31 OMA 2 WFI False 3 0
32 OCAM2009 2 OCAM False 10 0
33 VIRCAM@VISTA 4 VIRCAM True public 1
34 VIKING 2 None False 36 7
35 ESOSCHMIDT@ESO1m 5 ESOSCHMIDT True public 2
36 OMEGACAM@VST 4 OMEGACAM True public 10
37 EUCLID 2 None False 49 1
38 OMEGAWHITE 2 OMEGACAM False 8 6
39 ACAM@WHT 4 ACAM True public 3
4 PDS 4 PDS True public 0
40 OMEGADWARFS 2 OMEGACAM False 11 6
41 ATLAS 4 OMEGACAM True public 4
42 VPHASPLUS 4 OMEGACAM True public 0
43 DECAM@BLANCO 4 DECAM True public 3
44 HERCULES 2 OMEGACAM False 11 6
45 VOICE 2 OMEGACAM False 21 4
46 FOCUS 2 OMEGACAM False 36 6
47 MICADO@E-ELT 4 MICADO True public 3
48 KIDS-PHOTZTEST 2 OMEGACAM False 6 4
49 SPARCS 2 DECAM False 5 5
5 WFC@INT 4 WFC True public 0
50 OMEGACLUSTER 2 OMEGACAM False 6 4
5030 DDT295A5030 2 OMEGACAM False 4 4
51 AMIGADEEP 2 OMEGACAM False 7 3
52 OMEGALAE 2 OMEGACAM False 5 3
53 DEEPCLUSTERS 2 WFC False 14 8
54 KABS 2 OMEGACAM False 13 2
6 WFI@2.2m 4 WFI True public 0
7 WENSS 4 WSRT True public 1
8 LOFAR 2 LOFAR False 4 0
9 SUP@SUBARU 4 SUP True public 1
9225 AWJMCFARLAND 0 None False 0 0
9233 AWDEMO 1 None False 0 0
AWAVENHOLAAWDBOXHOORNAWEHELMICH
AWGSIKKEMAAWJDEJONGAWJMCFARLAND
AWNCHOQUEAWPMANCERAPINA

None

AWBBURGGRAFAWCTRACHTERNACHAWDBOMANS
AWDROSENBAUMAWFBRIMIOULLEAWHHILDEBRANDT
AWHISRAELAWJDIETRICHAWKWEIS
AWMLERCHSTERAWOCORDESAWOSCHMITHUESEN
AWTERBENAWTSCHRABBACKKRAHE
AWARAJAWARIFATTOAWEPUDDU
AWEVALENTYNAWFGETMANAWFLABARBERA
AWGVERDOESAWJDEJONGAWKKUIJKEN
AWMDALLORAAWMPAOLILLOAWMRADOVICH
AWNNAPOLITANO
AWEHELMICHAWGCOVONEAWGVERDOES
AWMVACCARI
AWEHELMICHAWGVERDOES

KiDS ATLAS Bridging Survey

VST/OmegaCAM Exploration of SUperclusters Voids and Intermediate Objects

LOw Frequency ARray - The largest radio telescope in the world

AWEHELMICHAWGVERDOESAWJMCFARLAND

MYDB for AWDEMO

All users

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWKBEGEMANAWMTEMPELAARAWRVERMEIJ
AWWVRIEND

MICADO will be a near-infrared wide-field camera at the European Extremely Large Telescope.

All users

UKIDSS (UKIRT Infrared Deep Sky Survey) is the next generation near-infrared sky survey, the successor to 2MASS using the infrared WFCAM survey instrument attached to the UK InfraRed Telescope (UKIRT) on Mauna Kea, Hawaii. UKIDSS began in May 2005 and will survey 7500 square degrees of the Northern sky, extending over both high and low Galactic latitudes, in JHK to K=18.3. This depth is three magnitudes deeper than 2MASS. UKIDSS will be the true near-infrared counterpart to the Sloan survey, and will produce as well a panoramic clear atlas of the Galactic plane.

ACAM is mounted permanently at a folded-Cassegrain focus of the 4.2-m William Herschel Telescope. It can be used for high-throughput broad-band imaging, narrow-band imaging and low-resolution spectroscopy.

AWABELIKOVAWGSIKKEMAAWGVERDOES
AWASAVINOAWEHELMICHAWJDEJONG
AWMMAHLKEAWNCHOQUEAWPMANCERAPINA
AWTNUTMA

All users

AWEVALENTYNAWGVERDOESAWJMCFARLAND
AWACHOIAWCHEYMANSAWCSIFON
AWDAPPLEGATEAWDBOXHOORNAWEHELMICH
AWFGETMANAWGCOVONEAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJDEJONGAWJMCFARLANDAWKKUIJKEN
AWMRADOVICHAWMVACCARIAWMVIOLA
AWNNAPOLITANOAWRVANDERBURGAWTERBEN
AWGVERDOES

All users

All users

Sandbox for Astro-WISE tutorial users.

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWKBEGEMANAWMTEMPELAARAWRVERMEIJ
AWWVRIEND
AWEHELMICHAWGVERDOESAWJHOLT
AWJMCFARLANDAWMFRANX
AWEHELMICH
AWADVORNIKAWAGRADOAWARAJ
AWARIFATTOAWCTORTORAAWDBOXHOORN
AWDKLAESAWEDEULAWEHELMICH
AWEPUDDUAWEVALENTYNAWFGETMAN
AWGCOVONEAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLAND
AWKKUIJKENAWMBILICKIAWMDALLORA
AWMIRWINAWMPAOLILLOAWMRADOVICH
AWNNAPOLITANOAWOCORDESAWPHUDELOT
AWTERBEN

All public data for OmegaCAM. OmegaCAM is a 1 square degree wide field, optical, 16k X 16k pixel camera for the VLT Survey Telescope (VST) on Paranal Observatory.

Ultra deep near-infrared survey for the early Universe.

AWJMCFARLAND
AWEHELMICHAWGVERDOESAWJMCFARLAND

Euclid is an ESA medium class mission selected for launch in 2019 in the Cosmic Vision 2015-2025 programme

AWABELIKOVAWACHOIAWADVORNIK
AWAEDGEAWAGRADOAWARAJ
AWARIFATTOAWATUDORICAAWAWRIGHT
AWBALTIERIAWBJOACHIMIAWBVENEMANS
AWCHEYMANSAWCMORRISONAWCSIFON
AWCSPINIELLOAWCTORTORAAWDBOXHOORN
AWDKLAESAWDWILLIAMSAWEDEUL
AWEHELMICHAWEIODICEAWEPETRILLO
AWEPUDDUAWEVALENTYNAWEVANUITERT
AWFGETMANAWFKOEHLINGERAWFLABARBERA
AWGCOVONEAWGDAGOAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWHHOEKSTRAAWJDEJONGAWJMCFARLAND
AWJPEACOCKAWKBEGEMANAWKKUIJKEN
AWLKELVINAWLMILLERAWMBILICKI
AWMCAPACCIOLIAWMCOSTADUARTEAWMDALLORA
AWMIRWINAWMMAHLKEAWMPAOLILLO
AWMRADOVICHAWMSPAVONEAWMVIOLA
AWNNAPOLITANOAWOCORDESAWPHUDELOT
AWPNOORISHADAWPSCHNEIDERAWPSIMON
AWRHERBONNETAWRNAKAJIMAAWRPELETIER
AWRVANDERBURGAWSDRIVERAWTERBEN
AWTKITCHINGAWTLISKERAWTSCHRABBACKKRAHE
AWTSHANKSAWWSUTHERLANDAWWVRIEND
AWZHUANG
AWABELIKOV
AWATUDORICAAWAVENHOLAAWEHELMICH
AWEPETRILLOAWGVERDOESAWMVANDENBERG
AWSVATS
AWABELIKOVAWACHAMBALLUAWAJAFFE
AWAPIEMONTEAWATSYGANOVAWBDROEGE
AWBNICHOLAWCBACCIGALUPIAWCROUSSEL
AWCTAOAWDBOXHOORNAWEAUBOURG
AWEHELMICHAWEVALENTYNAWFABDALLA
AWFRAISONAWGBLANCAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJKOPPENHOEFERAWJMCFARLANDAWJMOHR
AWJPIZAGNOAWJSNIGULAAWKBEGEMAN
AWKGANGAAWKKUIJKENAWMJARVIS
AWMKUEMMELAWMSAUVAGEAWMVACCARI
AWMWETZSTEINAWNBUSCAAWOLAHAV
AWOMARGGRAFAWPHUDELOTAWRCABANAC
AWRHENDERSONAWRSAGLIAAWRWILLIAMS
AWSDESAIAWSSERJEANTAWTERBEN
AWTGIANNANTONIOAWVBECKMANNAWWVRIEND
AWYMELLIER

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

All public data for MDM8K

AWEHELMICHAWETOLSTOYAWGSIKKEMA
AWGVERDOESAWJDEJONGAWTDEBOER

The Large Binocular Camera (red arm) at the Large Binocular Telescope at Mount Graham

This project contains all public data from the MONICA CCD camera on the 0.8m telescope at Wendelstein Observatory, operated by the Institute for Astronomy and Astrophysics of the University of Munich.

AWAKARICKAWCOMALSAWDBOXHOORN
AWEHELMICHAWEVALENTYNAWGVERDOES
AWJMCFARLANDAWLDOMINGUEZAWMDENBROK
AWMTEMPELAAR
AWGSIKKEMAAWGVERDOESAWJBOUT
AWABELIKOVAWBPILADIEZAWBVENEMANS
AWCBLOKZIJLAWCSIFONAWDBOXHOORN
AWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWHHILDEBRANDT
AWJBOUTAWJDEJONGAWJMCFARLAND
AWJMWEBAZEAWJPIZAGNOAWKBEGEMAN
AWKKUIJKENAWMCACCIATOAWMCAPACCIOLI
AWMNEESERAWMRADOVICHAWNIRISARRI
AWNWISSEAWPHERAUDEAUAWRBENDER
AWRSAGLIAAWRSILVOTTIAWRVANDERBURG
AWRWILLIAMSAWSCASEWELLAWSVLAAR
AWTERBENAWWVRIENDAWYMELLIER

OmegaCAM lab tests

The Spitzer Adaptation of the Red-sequence Cluster Survey is a z'-passband imaging survey of the SWIRE Legacy Survey Fields. Observations of the six fields have been made at all seven Spitzer (3.6, 4.5, 5.8, 8.0, 24, 70, 160 micron) passbands. SpARCS consists of deep (z'= 24 AB) observations made from both hemispheres using MegaCam at CFHT (Northern Fields) and MOSAICII at CTIO (Southern Fields). The cluster detection (z'-imaging) phase is now complete and has yielded hundreds of z > 1 cluster candidates detected based upon z'-[3.6] color. With a total effective area of 41.9 square degrees, SpARCS is currently the largest completed z > 1 cluster survey. This project is for the processing of new (DECAM) and legacy SpARCS data.

AWADVORNIKAWCSPINIELLOAWEHELMICH
AWEIODICEAWGDAGOAWGVERDOES
AWJDEJONGAWJMCFARLANDAWLKELVIN
AWMBILICKIAWMSPAVONEAWRPELETIER
AWTSAIFOLLAHI

Search for faint features in the outskirts of isolated galaxies

Astro-Wise Workshop - 14-18 November 2005, Lorentz Center, Leiden.

All users

Project for the public data from the ANDICAM (A Novel Dual Imaging CAMera) mounted on the former 1.3m 2MASS telescope at Cerro Tololo observatory, Chile. The ANDICAM has two detectors that can operate simultaneously, observing the same pointing in both the optical and near-infrared.

AWDBOXHOORNAWEHELMICHAWGVERDOES
AWHHILDEBRANDTAWJDEJONGAWKKUIJKEN

MegaPrime is the wide-field optical imaging facility at CFHT (Canada-France-Hawaii telescope) atop Mauna Kea, Hawaii. At the heart of MegaPrime is the wide-field imager, MegaCam, consisting of 36 2048 x 4612 pixel CCDs (a total of 340 megapixels), covering a full 1 degree x 1 degree field-of-view with a resolution of 0.187 arcsecond per pixel to properly sample the 0.7 arcsecond median seeing offered by the CFHT at Mauna Kea.

AWDBOXHOORNAWDSOBRALAWGVERDOES
AWJMATTHEEAWJMCFARLAND
AWDBOXHOORNAWEHELMICHAWGVERDOES
AWMHEEMSKERKAWMVANDENBERGAWSVATS

One of three large surveys on the William Herschel Telescope (WHT) will be WEAVE-Clusters using the WEAVE Spectrograph. This will study cluster evolution through an analysis of the internal kinematics and stellar populations of dwarf galaxies. In preparation of this survey, deep imaging will be obtained with Wide Field Camera (WFC) on the Isaac Newton Telescope (INT) for some of these clusters. The resulting data set will be analyzed using special photometric techniques developed for the VST-Fornax Survey.

All public data for PDS

AWJMCFARLAND
AWEHELMICHAWGVERDOESAWJDEJONG
AWJMCFARLAND

All users

All users

Test project for AIUB

AWAUSOVAWDBOXHOORNAWEVALENTYN
AWWVRIEND

All users

AWWVRIEND

DECam is the 3 square-degree (2.2 degree wide) Dark Energy Camera mounted on the 4.0m Blanco telescope at Cerro Tololo Inter-American Observatory (CTIO) in central Chile for the purpose of collecting data for DES, the Dark Energy Survey.

AWDBOXHOORNAWEHELMICHAWGRAMSAY
AWGVERDOESAWKBEGEMANAWPGROOT
AWRTOMAAWSMACFARLANE
AWJMCFARLAND

All users

None

All public data for OCAM

AWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJMCFARLANDAWKBEGEMANAWWVRIEND

VST GTO Hercules supercluster

Project for the public data from the 0.4m Gratama telescope at the Blaauw Observatory atop the Bernoulliborg in Groningen, The Netherlands, run by the Kapteyn Institute.

A census of the close-binary population in old open clusters.

AWDBOXHOORNAWEHELMICHAWGVERDOES
AWKBEGEMANAWPGROOTAWSMACFARLANE
AWATUDORICAAWEHELMICHAWGVERDOES
AWHHILDEBRANDTAWJMCFARLAND
AWARAJAWFGETMAN
AWATUDORICAAWEHELMICHAWGVERDOES
AWHHILDEBRANDTAWJMCFARLAND

All users

AWDBOXHOORNAWEVALENTYNAWGVERDOES
AWJBOUTAWJMCFARLANDAWKBEGEMAN
AWAGRADOAWANONYMOUSAWAROJBI
AWCHAINESAWDBOXHOORNAWDWILMAN
AWEBERTINAWEDEULAWEHELMICH
AWEVALENTYNAWFGETMANAWGFEULNER
AWGSIKKEMAAWGVERDOESAWHHILDEBRANDT
AWJDIETRICHAWJKOPPENHOEFERAWJMCFARLAND
AWJSNIGULAAWKBEGEMANAWKKOVAC
AWKKUIJKENAWLHABERZETTLAWLMORALESRUEDA
AWMNEESERAWMPAVLOVAWMPOHLEN
AWMSMITAWMTEMPELAARAWNRAMANUJAM
AWOCORDESAWOSCHMITHUESENAWPGROOT
AWPHERAUDEAUAWRRENGELINKAWRSILVOTTI
AWRVERMEIJAWSLECCIAAWTERBEN
AWTSCHNEIDERAWWVRIENDAWYMELLIER

Data for the VISTA Kilo-degree Infrared Galaxy survey.

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWJBOUT
AWJMCFARLANDAWKBEGEMANAWLKELVIN
AWRBUTAAWWVRIEND
AWABELIKOVAWEHELMICHAWGVERDOES
AWHBUDDELMEIJERAWJMCFARLANDAWKBEGEMAN
AWDBOXHOORNAWEHELMICHAWETOLSTOY
AWEVALENTYNAWGSIKKEMAAWGVERDOES
AWHBUDDELMEIJERAWJDEJONGAWJMCFARLAND
AWKKUIJKENAWTDEBOER

All users

Search for comets

This project contains data taken during the OmegaCAM integration test of October 2008. Instrument and detector were reassembled on Paranal, but not joined together. The shutter and filter mechanics were operated but not present in front of the detector.

The Wide-field Imaging Survey Evaluation of Readiness (WISER) project seeks to evaluate the readiness of our system to deal with large-scale survey data from wide-field imagers.

FOrnax Cluster Ultradeep Survey

Einstein cross around a massive super-compact galaxy in the KiDS survey: a VST follow-up

All users

OMA (ontological machine for Astro-Wise) is a prototype of the system for incorporation of external data sources in Astro-Wise. It will be used to test scientific use cases for OMA as well.

AWEHELMICHAWGVERDOESAWJHOLT
AWJMCFARLANDAWMFRANXAWRWILLIAMS
AWJMCFARLAND
AWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJDEJONG
AWJMCFARLANDAWKBEGEMANAWWVRIEND

All users

All users

WFCAM is a near-IR wide field camera for the UKIRT telescope on Mauna Kea, Hawaii that has been designed specifically to carry out large-scale survey observations such as the UKIRT Infrared Deep Sky Survey (UKIDSS).

Sandbox for Astro-WISE tutorial users.

Contains scans of photographic plates taken with the ESO Schmidt 1m telescope on La Silla.

AWEHELMICHAWGVERDOESAWJDEJONG
AWJMCFARLAND

Testing the photometric redshift and shear measurements of the Kilo Degree Survey

AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGSIKKEMAAWGVERDOESAWJBOUT
AWJDEJONGAWJMCFARLAND
AWDBOXHOORNAWEHELMICHAWEVALENTYN
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWKBEGEMANAWMTEMPELAARAWRVERMEIJ
AWWVRIEND

OmegaCAM/VST Guaranteed Time

The Westerbork Northern Sky Survey

The Large Binocular Camera (blue arm) at the Large Binocular Telescope at Mount Graham

AWABELIKOVAWDBOXHOORNAWEHELMICH
AWGVERDOESAWJMCFARLANDAWJMWEBAZE
AWKBEGEMANAWWVRIEND

Subaru is an 8.2 meter optical-infrared telescope at the summit of Mauna Kea, Hawaii, operated by the National Astronomical Observatory of Japan (NAOJ), National Institutes of Natural Science. SuprimeCam is the 10k x 8k mosaic camera at the prime focus.

The VST/OmegaCam Photometric H¿ Survey of the Southern Galactic Plane.

All users

AWDBOXHOORNAWJDEJONGAWJMCFARLAND
AWNNAPOLITANO

All users

Groningen tutorial, July 10 and 11.

The HST-ACS Coma Legacy Survey

All users

AWADVORNIKAWDBOXHOORNAWEHELMICH
AWEVALENTYNAWGSIKKEMAAWGVERDOES
AWJBOUTAWJDEJONGAWJMCFARLAND
AWMBILICKI

All public data for WFI

AWABELIKOVAWEHELMICHAWGVERDOES
AWJBOUTAWJMCFARLANDAWJPIZAGNO
AWRWILLIAMS
AWARAMESHAWAVENHOLAAWBLAP
AWDBOXHOORNAWEHELMICHAWGSIKKEMA
AWGVERDOESAWJDEJONGAWJMCFARLAND
AWJVANDENBORNAWNCHOQUEAWPMANCERAPINA
AWRPELETIERAWTVOS

All users

AWABOSELLIAWAGRADOAWAHELMI
AWAVENHOLAAWDBOXHOORNAWEGREBEL
AWEHELMICHAWEIODICEAWELAURIKAINEN
AWETOLOBAAWEVALENTYNAWFLABARBERA
AWGHENSLERAWGSIKKEMAAWGVANDEVEN
AWGVERDOESAWHBUDDELMEIJERAWHSALO
AWJDEJONGAWJFALCONBARROSOAWJJANZ
AWJMCFARLANDAWKKUIJKENAWMCAPACCIOLI
AWMHILKERAWMPAOLLILOAWNNAPOLITANO
AWRMUNOZAWRPELETIERAWSMIESKE
AWSPAUDELAWSTRAGERAWTLISKER
AWTPUZIAAWTSAIFOLLAHIAWVSPRINGEL

The Altas3D Survey is a proposed project to observe a complete sample of all early-type galaxies within the local (40Mpc) volume, using the SAURON integral-field spectrograph on the William Herschel Telescope.

AWABELIKOVAWDBOXHOORNAWEDEUL
AWEHELMICHAWEVALENTYNAWGSIKKEMA
AWGVERDOESAWHBUDDELMEIJERAWJBOUT
AWJDEJONGAWJMCFARLANDAWJPIZAGNO
AWKBEGEMANAWKKUIJKENAWRHOOK
AWWVRIEND

All users

The HST-ACS Coma Legacy Survey uses new data from the Hubble Space Telescope's Advanced Camera for Surveys and legacy data sources such as Subaru, Isaac Newton Telescope, etc. to study the nature of objects in and around the Coma Cluster.

All users

AWEHELMICHAWJDEJONG
AWAVENHOLAAWDBOXHOORNAWEHELMICH
AWGVERDOESAWJMCFARLANDAWPRAMIREZMORETA
AWRPELETIER
AWGVERDOESAWJBOUT

The initial aim of ATLAS is to survey 4500 deg2 of the Southern Sky at high galactic latitudes to comparable depths to the SDSS in the North. The VST ATLAS will be the first step towards a panoramic digital survey of the Southern Sky in the optical bands.

AWDBOXHOORNAWJDEJONGAWJMCFARLAND
AWNNAPOLITANO

All users

AWGVERDOESAWJMCFARLANDAWWVRIEND

Commissioning data for OmegaCAM, mostly taken from March through June of 2011.

AWJMCFARLAND
AWJMCFARLAND

Leiden Tutorial. August 18-20.

AWDBOXHOORNAWGVERDOESAWJMCFARLAND
AWAVENHOLAAWEHELMICHAWGSIKKEMA
AWGVERDOESAWJMCFARLANDAWRPELETIER

MYDB for JMCFARLAND

INT data for Virtual Observations lecture series

AWEDEMOOIJAWEDEULAWEHELMICH
AWEVANUITERTAWGVERDOESAWHHILDEBRANDT
AWISNELLENAWJHOLTAWJMCFARLAND
AWKKUIJKENAWKVERBEEKAWMFRANX
AWMSMITAWMVELANDERAWOSPOOREN
AWRWILLIAMSAWTSCHRABBACKKRAHE

The nature, clustering and evolution of Lyman-¿ emitters with the largest Lyman-¿ survey at z ¿ 2.4

AWJMCFARLAND

All public data for all instruments

AWEHELMICHAWGVERDOESAWMVANDENBERG
AWSVATS

VOICE aims at covering 4 square degrees around the CDFS in deep ugri imaging.

1700 Square degree 5 band survey of the equatorial strip and 2dF South region

All public data for WFC

All users

All users

AWATUDORICAAWGVERDOESAWJMCFARLAND
AWEHELMICHAWGVERDOESAWJDEJONG
AWKKUIJKEN
AWEHELMICHAWGVERDOES

For testing purposes only.

All users

All users

All public data for VIRCAM

OmegaWhite is a variability survey aimed at periods of less than 2 hours. Using the wide-field camera OmegaCam on the VLT Survey Telescope (VST) 400 square degrees will be monitored for 2 hours in g' and in addition colour information will be obtained by imaging the same area in u', r', i' and narrow band He (5015) and Halpha filters. OmegaWhite is part of the European Galactic Plane Surveys (EGAPS). For additional information on OmegaWhite please have a look at this OmegaWhite survey website - http://www.astro.ru.nl/omegawhite/

All public data for ACS

In december 2009 the CCD 'Sculptor' of the OmegaCAM detector was replaced. The data in this project were taken to confirm the success of this procedure. RawFitsData were created artificially; the order of extensions is not constant or the same as in the other OCAM datasets.

All users

empowered by

logo